PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 396aa    MW: 44061.3 Da    PI: 8.2807
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002399genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63e-14241294558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  +  e+ ++ ++
  Lus10002399 241 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKELNEELERKQAEIMQMQQN 294
                  79************************************9998888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-13237301IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737239290IPR004827Basic-leucine zipper domain
PfamPF001704.9E-12241293IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-10241290No hitNo description
CDDcd147079.38E-25241295No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-13241289No hitNo description
PROSITE patternPS000360244259IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGSHFNFSSF GNPTNSPLVR QQSSVYSLTF DELQNTWGGS IGKDFWSMNM DELLKNICTA  60
EETSTIGVVE EASTGNLQRQ GSLTLPRTLS QKTVDEVWKD FIKENSVNAA ASKNDVTRPR  120
VQLSCSNLGL NVGGIRPPPH QQQHQQSFHR SRNQPQQQQQ QPLLFPKPAT VPFASPVHNK  180
VNGGRSSAAG VTVATASPAS QGSPDVLSRS DADTSSVSPV PYVFSSRGRR PNTALEKVVE  240
RRQRRMIKNR ESAARSRARK QAYTLELEAE VAKLKELNEE LERKQAEIMQ MQQNQVSKSS  300
SLCESFLLYY NSSNPSLICR CHEKGVHLDA RIFYRSEFYC DFAVLGENEA SMGRQAALLE  360
EDTDGAMVES QNQLDIVSKH HVRDSTIIIA YKYLC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373134.12e-81PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_008373133.12e-81PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q51e-60AI5L4_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLA0A0D2NHM86e-82A0A0D2NHM8_G
STRINGBra001742.1-P2e-73(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.33e-31abscisic acid responsive elements-binding factor 3